West Nile Virus Pre-M Recombinant ( WNV Pre-M )

West Nile Virus Pre-M Recombinant ( WNV Pre-M )
$275.00

DescriptionThe E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.MethodPurified by proprietary chromatographic technique.PurityProtein is >95% pure as
Formulation
20mM phosphate buffer pH 7.5.
Purity
Protein is >95% pure as determined by SDS-PAGE.
Applications
Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.
Description
The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.
Protein Background
West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.
Expression host
Escherichia Coli.
Stability
WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Amino acid sequence
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.

 

All of Novateinbio's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to Novateinbio that you will properly test and use any Products purchased from Novateinbio in accordance with industry standards. Novateinbio and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Cart

No products

Shipping $0.00
Tax $0.00
Total $0.00

Cart