> >>TRAF6 Antibody
TRAF6 Antibody View larger

TRAF6 Antibody

ASA-B1907

$365.00

More info

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 
TNF receptor-associated factor 6, E3 ubiquitin protein ligase Polyclonal IgG Rabbit Human, Mouse, Rat WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human TRAF6 (99-130aa RDAGHKCPVDNEILLENQLFPDNFAKREILSL), identical to the related mouse and rat sequences.

Properties

Form

 Lyophilized

Size

 100 µg/vial

Contents

 Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

 Reconstitute with 0.2 mL sterile dH2O (500 µg/ml final concentration).

Storage

 At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

 TRAF6

Protein

 TNF receptor-associated factor 6

Uniprot ID

 Q9Y4K3

Function

 E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as IKBKG, IRAK1, AKT1 and AKT2. Also mediates ubiquitination of free/unanchored polyubiquitin chain that leads to MAP3K7 activation. Leads to the activation of NF-kappa-B and JUN. May be essential for the formation of functional osteoclasts. Seems to also play a role in dendritic cells (DCs) maturation and/or activation. Represses c- Myb-mediated transactivation, in B-lymphocytes. Adapter protein that seems to play a role in signal transduction initiated via TNF receptor, IL-1 receptor and IL-17 receptor. Regulates osteoclast differentiation by mediating the activation of adapter protein complex 1 (AP-1) and NF-kappa-B, in response to RANK-L stimulation. Together with MAP3K8, mediates CD40 signals that activate ERK in B-cells and macrophages, and thus may play a role in the regulation of immunoglobulin production.

Tissue Specificity

Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Sub-cellular localization

 Cytoplasm.

Sequence Similarities

 Belongs to the TNF receptor-associated factor family. A subfamily.

Aliases

 E3 ubiquitin-protein ligase TRAF6 antibody|Interleukin 1 signal transducer antibody|Interleukin-1 signal transducer antibody|MGC 3310 antibody|MGC:3310 antibody|MGC3310 antibody|OTTHUMP00000232772 antibody| OTTHUMP00000232773 antibody|RING finger protein 85 antibody|RNF 85 antibody|RNF85 antibody|TNF receptor associated factor 6 antibody|TNF receptor-associated factor 6 antibody|TRAF 6 antibody|Traf6 antibody|TRAF6_HUMAN antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Mouse, RatAssaySolutio's ECL kit

AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information
Anti- TRAF6 antibody, ASA-B1907, Western blotting
All lanes: Anti (PB) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Skeletal Muscle Tissue Lysate at 50ug
Lane 3: Mouse Brain Tissue Lysate at 50ug
Lane 4: PANC Whole Cell Lysate at 40ug
Lane 5: A549 Whole Cell Lysate at 40ug
Lane 6: HELA Whole Cell Lysate at 40ug
Lane 7: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 80KD
Observed bind size: 80KD

© 2024 Novateinbio.com